Everything below concerns anxiolytic. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-01-11. Where a claim depends on a specific study, the study is described rather than over-claimed.
Lyophilized material is generally stable for extended periods when kept dry at or below minus twenty degrees Celsius. Working solutions are less stable, and common practice is to aliquot and freeze them so that repeated freeze-thaw cycles are avoided. Aqueous solutions are sensitive to pH extremes and to microbial growth, so short-term storage at refrigerator temperature is typical. Oxidation and hydrolysis are the principal degradation routes. Reconstitution with sterile water or a mild buffer is standard, and solutions should be protected from light.
Regulatory treatment varies by jurisdiction. In Russia the compound is a registered prescription product, while in the European Union and the United States it is generally handled as a research chemical without a marketing authorization. Suppliers therefore operate outside pharmaceutical oversight, and buyers rely on supplier documentation for purity and identity claims. Chain of custody and third-party testing are the main verification tools. Analysts note that the absence of a pharmacopoeial monograph for research-grade material limits standardization across vendors.
Purity assessment relies mainly on reverse-phase high-performance liquid chromatography with ultraviolet detection. Because the peptide lacks a strong chromophore, detection often uses backbone absorbance near 214 nm. Identity is confirmed by mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, comparing the measured mass against the expected value. Amino acid analysis can verify composition after acid hydrolysis. Diastereomer content and residual counterions are reported less often, although both can influence biological assays.
Handling follows standard practice for research peptides. Material is weighed in a low-humidity environment because the powder absorbs atmospheric moisture. Purity is reported as the percentage area of the main peak in a chromatogram, with specifications commonly set at 95 percent or higher; values below that threshold indicate the presence of truncated or modified species. Residual trifluoroacetate from purification is often present and may affect mass balance. Certificates of analysis should state the analytical method, the column and gradient used, and the lot-specific retention time so that results can be compared across suppliers.
Identity and purity of selank are established with reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The peptide elutes from C18 columns with acetonitrile gradients in water containing trifluoroacetic acid or formic acid, and detection is usually performed by ultraviolet absorbance near 214 nm. Electrospray ionization in positive mode gives a doubly protonated ion near m/z 377, consistent with a mass of about 752 Da. Amino acid analysis or tandem mass spectrometry of fragment ions confirms the sequence. Because the molecule has no aromatic residues, it lacks a usable 280 nm chromophore, so low-wavelength detection or mass spectrometry is required.
Peptide bonds in selank are susceptible to hydrolysis under strongly acidic or basic conditions, and the terminal proline residues are vulnerable to exopeptidase activity in biological samples. Lyophilized powder stored dry at -20 °C typically remains stable for extended periods, whereas aqueous solutions degrade faster and may lose measurable purity within days to weeks depending on pH, temperature, and microbial load. Repeated freeze-thaw cycles promote aggregation and adsorption to container surfaces. For analytical work, solutions are usually prepared fresh, kept cold, and used within a single working day.
| Property | Value | Notes |
|---|---|---|
| Typical purity report | 95% or higher by HPLC | Area percentage at 214 nm |
| Identity confirmation | Mass spectrometry | Electrospray or MALDI |
| Powder storage | -20 C, desiccated | Protect from light |
| Solution storage | 2-8 C short term | Freeze aliquots for longer |
| Quality document | Certificate of analysis | States method and value |
Tuftsin, the parent structure, is a naturally occurring immunomodulatory tetrapeptide released from the Fc region of immunoglobulin G by spleen enzymes. Selank extends this four-residue sequence with three additional amino acids. The stated rationale is that the added tail slows enzymatic breakdown and may influence receptor interactions. How the full heptapeptide behaves at the molecular level is not firmly established, and proposed mechanisms often involve indirect modulation of neurotransmitter or immune signaling rather than a single defined target.
Selank is a synthetic heptapeptide developed in Russia. Its sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, a seven-residue chain built around the natural tetrapeptide tuftsin. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences first described the compound in the mid-1990s. The design combined the tuftsin core with an added Pro-Gly-Pro tail, a modification intended to extend the molecule's stability in biological fluids. Published work on the peptide has appeared mainly in Russian-language journals.
Proposed mechanisms centre on modulation of the GABAergic system, with reports of altered expression of genes related to GABA-A receptor subunits and changed monoamine turnover. Some studies describe inhibition of enkephalinase, the enzyme that degrades endogenous enkephalins, which may prolong opioid peptide signalling. Effects on brain-derived neurotrophic factor and on cytokine expression have also been reported. These findings come largely from animal models and small human studies, and the precise primary target remains unresolved.
Published clinical evidence is limited. Most controlled trials were conducted in Russia, enrolled modest numbers of participants, and appeared in Russian-language journals, which restricts independent verification. Reported outcomes include lower anxiety scores, improved attention and memory measures, and changes in fatigue ratings. Reviews written in English note methodological limitations such as small samples and inconsistent endpoints. Whether the compound produces clinically meaningful benefit relative to established anxiolytics is therefore an open question rather than an established finding.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences as a structural analogue of tuftsin, a naturally occurring tetrapeptide fragment of the immunoglobulin heavy chain. The added Pro-Gly-Pro tail was intended to slow enzymatic degradation and extend biological activity. In Russia it is registered as an anxiolytic nasal preparation, while regulators elsewhere have not approved it for clinical use.
Published clinical work is concentrated in Russian-language journals and generally involves small samples without independent replication. Systematic reviews in English note the shortage of randomised, placebo-controlled trials and the difficulty of verifying methods from translated reports. Outcome measures vary between studies, which complicates pooling of results. Interest in the compound as a cognitive or anxiolytic agent therefore rests on a thinner evidence base than the volume of citations suggests. Replication in well-powered trials with preregistered endpoints would be needed before firm conclusions about efficacy can be drawn.
Proposed mechanisms centre on the GABAergic system. Animal and tissue studies report changes in GABA-A receptor expression and reduced activity of GABA transaminase, the enzyme that degrades GABA. Effects on monoamine turnover, including serotonin and dopamine pathways, are also described, and a separate line of work links the peptide to increased expression of brain-derived neurotrophic factor in hippocampal tissue. Most of these findings come from rodent models and cell preparations. How the individual observations combine into a single coherent mode of action is not settled.
== Demographics == As of 2018, 360,589 people were enrolled in the Cherokee Nation as citizens. Citizens live in every state, with 2018 populations of 240,417 in Oklahoma, 22,124 in California, 18,406 in Texas, 12,734 in Arkansas, 11,014 in Kansas, and less than 10,000 in each other state. By 2021, enrollment reached 400,000, making the Cherokee Nation the second most populous tribe, closely behind the Navajo Nation. About 140,000 citizens live in the Cherokee Nation reservation area. In 2023, the nation's enrollment reached 450,000. In 2024, the nation released updated demographics maps showing the nation's total population in the United States was approximately 466,118.
=== Computing === Hyperlink, from one electronic document to another link (Unix), a command-line program to link directory entries <link>, a type of HTML element Link, in a linked list Linker (computing), a program which converts object files to an executable Links (web browser) Microsoft Office Assistant Links, an animated cat Link layer in computer networking ln (Unix), a command-line program to create a link to a file Chainlink (blockchain), a cryptocurrency Link, an Internet wallet service from Stripe, Inc.
== Career and research == Ly is a full professor in the Department of Chemistry at Carnegie Mellon University, where he leads a multidisciplinary research group focused on synthetic biomolecules, DNA and RNA recognition, and molecular engineering. His laboratory has published on electron transport mechanisms in double-stranded DNA and the development of conformationally preorganized peptide nucleic acids (PNAs). This includes designing molecules capable of recognizing double-helical DNA or RNA through Watson-Crick base pairing. He also developed bifacial (Janus) nucleic acid recognition elements designed to bind to sequences of double-stranded DNA and target secondary or tertiary structures of RNA. In the biotechnology sector, Ly has co-founded startups based on his research, including Xpeutics, Vera Therapeutics (formerly PNA Innovations), and NeuBase Therapeutics (formerly ChiraGen).
== Similar forms == Arenobufagin is a derivative of the so-called bufadienolides, where it also has a steroid structure. A characteristic of bufadienolides is that they all contain two double bonds in the lactone ring.
Formol titration, invented by the Danish chemist S. P. L. Sørensen in 1907, utilizes formaldehyde in the presence of potassium or sodium hydroxide to measure amino acid concentration and ammonia with the aid of a pH meter. The reagents will also react with proline which can give a slightly higher YAN measurement than NOPA. The formol titration method also has the disadvantages of involving the use and disposal of formaldehyde which is a known carcinogen and the highly toxic reagent barium chloride. Ammonia and ammonium can be measured using an ion-selective electrode and a pH meter.
Sources: en.wikipedia.org
Idris' government was increasingly unpopular by the late 1960s, having exacerbated Libya's traditional regional and tribal divisions by centralizing the country's federal system to take advantage of the country's oil wealth. Corruption and entrenched patronage systems were widespread throughout the oil industry. Arab nationalism was increasingly popular, and protests flared up after Egypt's 1967 defeat in the Six-Day War with Israel; Idris' administration was seen as pro-Israeli due to its alliance with the West. Anti-Western riots broke out in Tripoli and Benghazi, while Libyan workers shut down oil terminals in solidarity with Egypt. By 1969, the US Central Intelligence Agency (CIA) was expecting segments of Libya's armed forces to launch a coup. Although claims have been made that they knew of Gaddafi's Free Officers Movement, they have since claimed ignorance, stating that they were instead monitoring the Black Boots revolutionary group of Abdul Aziz Shalhi, Idris' de facto chief of staff. Shalhi and his brother Omar were the sons of Idris' former chief advisor Ibrahim Shalhi, who had been murdered by Queen Fatima's nephew in 1954. After their father's assassination, they became the favorites of Idris. In mid-1969, Idris spent the summer in Turkey and Greece amid widespread rumors of an abdication or a British-backed coup by the Shalhi brothers on 5 September. Gaddafi's Free Officers, recognizing this as their last chance to preempt the Shelhis in overthrowing the monarchy, initiated "Operation Jerusalem".
== Development and applications == nanoCLAMPs were developed in the laboratories of Nectagen. nanoCLAMP phage display libraries were constructed that contained variations on 16 surface amino acids in three loops with function diversities of approximately 109 variants. These libraries have been screened for binders to target proteins and peptides, typically yielding between 1 and 30 unique binders to the target. Purified nanoCLAMPs containing a single C-terminal cysteine can be easily conjugated to halo-acetyl activated agarose resins under native or denaturing conditions, and the resulting thioether bond renders the resins leach-proof. Targets can be purified to apparent homogeneity in a single-step. The polyol-responsive nature of the resins allows the targets to be eluted with 0.75 M ammonium sulfate and 40% propylene glycol at pH 7.9, conditions which have been shown to preserve native structure and protein complexes. nanoCLAMPs have been produced that target green fluorescent protein (GFP), mCherry, SUMO (SMT3), NusA, avidin, NeutrAvidin, maltose-binding protein (MBP), thioredoxin 1, beta-galactosidase, SlyD, and others. Typical binding capacities of resins range from 1 to 4 mg/ml resin. Because nanoCLAMPs readily refold, nanoCLAMP resins can be regenerated multiple times using guanidinium chloride to clean the resin.
A diglyceride, or diacylglycerol (DAG), is a glyceride consisting of two fatty acid chains covalently bonded to a glycerol molecule through ester linkages. Two possible forms exist, 1,2-diacylglycerols and 1,3-diacylglycerols. Diglycerides are natural components of food fats, though minor in comparison to triglycerides. DAGs can act as surfactants and are commonly used as emulsifiers in processed foods. DAG-enriched oil (particularly 1,3-DAG) has been investigated extensively as a fat substitute due to its ability to suppress the accumulation of body fat; with total annual sales of approximately US$200 million in Japan since its introduction in the late 1990s till 2009.
== Clinical significance == NNMT is highly expressed in the human liver. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT expression in adipose tissue is associated with obesity and insulin resistance. Contrary to the negative effects of increased NNMT in adipose tissue, increased NNMT in liver is associated with a better metabolic profile, namely reduced serum triglycerides and free fatty acids. In adipose tissue, NNMT can lead to methylation depletion, whereas because of the many methylation enzymes in the liver NNMT has a negligible effect on liver methylation. But in the liver, the 1-methylnicotinamide produced by NNMT degradation of nicotinamide increases sirtuin 1 (SIRT1) by inhibiting degradation of that protein. Overexpression of SIRT1 in mice has been shown to reduce insulin and fasting glucose, as well as increased metabolism and physical function. Abundant availability of nicotinamide leads to depletion of both nicotinamide adenine dinucleotide (NAD+) and SAM-e, resulting in liver steatosis and fibrosis, causing the progression from non-alcoholic fatty liver disease (NAFLD) to non-alcoholic steatohepatitis (NASH). Human embryonic stem cells expression of NNMT is believed to help maintain the cells in a naive state. NNMT expression is significantly upregulated in many cancers, including pancreatic cancer where levels of NNMT enzyme correlate with increased risk of death. The cause of these correlations has not been established, but may be related to the fact that NNMT enzyme is an inhibitor of DNA repair.
=== Defects === There are two kinds of defects: Equilibrium defects, and Non-Equilibrium defects. Self-assembled structures contain defects. Dislocations caused during the assembling of nanomaterials can majorly affect the final structure and in general defects are never completely avoidable. Current research on defects is focused on controlling defect density.[23] In most cases, the thermodynamic driving force for self-assembly is provided by weak intermolecular interactions and is usually of the same order of magnitude as the entropy term. In order for a self-assembling system to reach the minimum free energy configuration, there has to be enough thermal energy to allow the mass transport of the self-assembling molecules. For defect formation, the free energy of single defect formation is given by:
Sources: en.wikipedia.org
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
==== Immune regulation ==== Under glutamine-deprived conditions, α-ketoglutarate promotes naïve CD4+ T cells differentiation into inflammation-promoting Th1 cells while inhibiting their differentiation into inflammation-inhibiting Treg cells thereby promoting certain inflammation responses.
The Energy Performance of Buildings Directive 2010 aims to eliminate unclean materials and energy waste to have "nearly zero-energy buildings", particularly by setting standards for new buildings since 2020 and upgrading existing buildings by 2050. There is, however, no requirement yet that all buildings replace gas heating with electric or heat-pumps, have solar or wind energy generation, electric vehicle charging, and particular insulation standards, wherever possible.
== Treatment == The injury can be debilitating for athletes of many sports who need to accelerate, quickly change direction, or jump. Use of the toes is not possible during the healing process. Since the toes are necessary for proper push-off when accelerating, those sorts of athletic activities should be almost completely curtailed. An extended healing period of one or more months is often required. Because of the anatomy of the distal foot and the unique use of the foot, it is often impossible to properly tape or brace the joint. Although difficult, it is not impossible to tape the toe to limit extension (upward bend of toe). Additionally, wearing a shoe with a rigid sole (often a metal plate) and cushioned innersole will help minimize extension of the joint. Anti-inflammatory medication, as well as physical therapy, is recommended. Turf toe is usually healed in about 2–3 weeks. It can become more serious if left untreated, and may cause serious problems for the athlete. Treating the injury includes icing of the area, elevating the foot, or possibly the use of custom orthotics.
Sources: en.wikipedia.org
Purity is usually reported as an HPLC area percentage, most often measured at 214 nm. Identity is confirmed separately by mass spectrometry. A certificate of analysis should state both the method and the observed value.
Dry powder is kept frozen, desiccated, and shielded from light. Dissolved material is aliquoted and frozen to limit freeze-thaw cycles. Short-term refrigerated storage is common for working solutions.
Russia registers it as a prescription nasal product. Most other markets classify it as a research chemical with no approved medical use. Oversight of purity and labeling is consequently minimal in those markets.
Identity is confirmed by matching the retention time in reversed-phase chromatography against a reference standard and by measuring the molecular mass with mass spectrometry. Tandem mass spectrometry or amino acid analysis can verify the sequence of the seven residues. Because the peptide contains no aromatic amino acids, detection at 280 nm is not useful.